DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Vars1

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_035820.3 Gene:Vars1 / 22321 MGIID:90675 Length:1263 Species:Mus musculus


Alignment Length:176 Identity:40/176 - (22%)
Similarity:74/176 - (42%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PQHTVPTLED--DGHFIWDSHAISAYLVSKYGQSDTLYPKDL-----LQRAVVDQRLHFESGVVF 108
            |...:|.||.  .|.::|.:.|:          :..|:|..|     .:.||:.|:....:....
Mouse    53 PPPRLPALEQGPGGLWVWGAPAV----------AQLLWPAGLGGPGGSRAAVLVQQWVSYADTEL 107

  Fly   109 VNGLRGITKP---LFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITA 170
            :....|.|.|   |...||.  |:....|:.:..:.:|.:|..|.::|||..|:||.:.:|::..
Mouse   108 IPAACGATLPALGLRGPGQD--PQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALLL 170

  Fly   171 LAVFVVIDTVK--YANITAWIKRIEELPYYEEACGK-----GARDL 209
            ...:|:..:.:  :.|:|.|.......|.:....|:     |||.:
Mouse   171 PFRYVLDPSARRIWGNVTRWFNTCVRQPEFRAVLGEVALYSGARSV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 40/174 (23%)
Vars1NP_035820.3 GST_C_family 92..213 CDD:470672 27/122 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..294
PTZ00419 281..1263 CDD:240411
'HIGH' region 343..353
'KMSKS' region 861..865
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.