| Sequence 1: | NP_001286571.1 | Gene: | GstE8 / 37113 | FlyBaseID: | FBgn0063492 | Length: | 222 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_775370.1 | Gene: | eef1g / 195822 | ZFINID: | ZDB-GENE-020423-3 | Length: | 442 | Species: | Danio rerio |
| Alignment Length: | 206 | Identity: | 52/206 - (25%) |
|---|---|---|---|
| Similarity: | 86/206 - (41%) | Gaps: | 30/206 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 RAAKLTLAALGIPYEYVKIN--------TLAKETLSPEFLRKNPQHTVPTLE-DDGHFIWDSHAI 71
Fly 72 SAYLVSKYGQSDTLYPKDLLQRAVVDQRLHF-ESGVV-----FVNGLRGITKPLFATGQTTIPKE 130
Fly 131 RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITAL--AVFVVIDTVKYANITAWIKRIE 193
Fly 194 ELPYYEEACGK 204 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE8 | NP_001286571.1 | GstA | 4..196 | CDD:223698 | 50/196 (26%) |
| GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 22/69 (32%) | ||
| GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 28/122 (23%) | ||
| eef1g | NP_775370.1 | GST_N_EF1Bgamma | 4..82 | CDD:239342 | 22/75 (29%) |
| maiA | 5..201 | CDD:273527 | 51/199 (26%) | ||
| GST_C_EF1Bgamma_like | 91..213 | CDD:198290 | 28/121 (23%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 227..273 | ||||
| EF1G | 280..386 | CDD:279041 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||