DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gst-21

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:201 Identity:50/201 - (24%)
Similarity:81/201 - (40%) Gaps:38/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPYEYVKINTLAKETL--SPEFL---RKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSDTL 85
            |:|:|..:|....|..|  :||..   :|.|....|.|:.|...|..|.||:.||..::|.:.  
 Worm    38 GVPFEDSRIPVDMKTGLIMNPELADVKKKAPFGKYPVLKIDDIEIAQSAAINRYLARQFGFAG-- 100

  Fly    86 YPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIE---------IYDF 141
              |:.::.|..|.  :.:....:....|..   ::||.|.. |:|....:.|         .|:.
 Worm   101 --KNPIEEAQADS--YIDQCQEYNTSFRAC---MYATLQGK-PEEEVQKIREEVYIPAQNKFYEI 157

  Fly   142 VETFLTGH--DFIAGDQLTIADFSLITSITALAVFVVIDTV-KYANITAW----IKRIEELPYYE 199
            ....|..:  .|:.||.||.||..:...:.:|      ||: ...:..||    :|:.:| ..||
 Worm   158 FSDILNRNKSGFLVGDSLTWADLVIADHLYSL------DTMGMLTHEDAWRCETLKKFQE-KIYE 215

  Fly   200 EACGKG 205
            ....||
 Worm   216 HPLLKG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 46/190 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/55 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/131 (22%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 19/55 (35%)
PTZ00057 18..231 CDD:173353 50/201 (25%)
GST_C_Sigma_like 104..213 CDD:198301 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.