DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gst-43

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:211 Identity:66/211 - (31%)
Similarity:92/211 - (43%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETL-SPEFLRKNPQHTVPTLEDDGHF 64
            |:|.|||....|......::.||...|.|||..|:..::|:. :.||::.||...||||..:|..
 Worm     1 MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLS 65

  Fly    65 IWDSHAISAYLVSKYGQSDTLYPKDL----LQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQT 125
            :.:|.||..||...|.....| ||:|    ..||:.   ||..:.:          :||.|....
 Worm    66 LTESLAIIEYLDEAYPDPPFL-PKELDKRSYSRAIA---LHIVASI----------QPLQAINIH 116

  Fly   126 TIPKERYDAVIEIY--DFV-------ETFLTGHD--FIAGDQLTIADFSLITSITALAVFVVIDT 179
            .:..|:.....:.:  .||       |..|..|.  :..||||||||.:| .||...|....:|.
 Worm   117 KMLNEKEPGYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINL-PSIIYNAKIYKVDM 180

  Fly   180 VKYANITAWIKRIEEL 195
            .||..||    ||.|:
 Worm   181 SKYPTIT----RINEI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 64/208 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/116 (28%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 25/72 (35%)
maiA 5..211 CDD:273527 64/207 (31%)
GST_C_Zeta 90..207 CDD:198300 34/121 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.