DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:218 Identity:57/218 - (26%)
Similarity:89/218 - (40%) Gaps:36/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIW 66
            :|.|||.:.:|......:..||...|.|||..:|.|.|:. ..||...||...||.|:.:|..:.
 Worm     3 AKPILYSSWSSGCSSRVRTALALKKIDYEYQPVNLLNKQK-EQEFHGNNPAEKVPILKINGLTLT 66

  Fly    67 DSHAISAYLVSKYGQSDTLYPKDLL----------QRAVVDQRLHFESGVVFVNGLRGITKPLFA 121
            :|.||..||       |.:||...|          .||:.   .|..|.:..:.     .||::.
 Worm    67 ESMAIIEYL-------DEIYPDPPLLPKEPELKARARAIA---FHIASNIQPLQ-----NKPIYL 116

  Fly   122 TGQTTIPK------ERYDAVIEIYDFVETFLTGH--DFIAGDQLTIADFSLITSITALAVFVVID 178
            ......|.      :.:  :.:.:..:|..|..|  ||..|:|::|||..|.:.:........:|
 Worm   117 MLNEKEPGYGDFWCQHF--ISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAIEKYHVD 179

  Fly   179 TVKYANITAWIKRIEELPYYEEA 201
            ...|..||....::.|||.::.|
 Worm   180 MTPYPIITRISNKLAELPEFQVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 53/209 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/129 (21%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 26/78 (33%)
maiA 18..211 CDD:273527 52/203 (26%)
GST_C_Zeta 89..207 CDD:198300 26/124 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163432
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.