DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gst-24

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:210 Identity:55/210 - (26%)
Similarity:84/210 - (40%) Gaps:45/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ASPPVRAAKLTLAALGIPYEYVKINTLAKE--TLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISA 73
            |.|..:..||.    .:.:|.|:|.....|  .|.|    |.|...:|.|..||..|..|.||..
 Worm    15 AEPARQLFKLA----HVEFEDVRIENGTPEWGALKP----KTPFGQLPFLSVDGFEIPQSAAILR 71

  Fly    74 YLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLR---------------GITKPLFATG 123
            ||..|:|.:.....::....|:|||   |:.   ||..||               .|.|.:||..
 Worm    72 YLAKKFGYAGKTSEEEAWVDAIVDQ---FKD---FVTPLRQLIMAQRSGNAEEIERIQKEVFAPA 130

  Fly   124 QTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYA---NI 185
            :.|..|       .:...:|...:|  |:.||.:|.||..:...:|.:.:..|.|  |:.   .:
 Worm   131 RDTFFK-------ILNGILEKSKSG--FLVGDGVTWADLVIADILTTMEMLGVFD--KHGEEQKL 184

  Fly   186 TAWIKRIEELPYYEE 200
            .|..:::.|:|..:|
 Worm   185 AALREKVNEIPEIKE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 53/204 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/67 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/128 (24%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 22/67 (33%)
PTZ00057 6..208 CDD:173353 55/210 (26%)
GST_C_Sigma_like 85..191 CDD:198301 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.