DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Gsto1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:204 Identity:51/204 - (25%)
Similarity:81/204 - (39%) Gaps:49/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPE-FLRKNPQHTVPTLED-DGHFIWDS 68
            :|.....|..:...:.|.|.||.:|.:.||...|    || |..|||...||.||: .||.:.:|
Mouse    26 VYSMRFCPFAQRTLMVLKAKGIRHEVININLKNK----PEWFFEKNPLGLVPVLENSQGHLVTES 86

  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITK--PLFATGQTTIPKE- 130
            .....||...|.:. .|:|.|..::|  .|::..||          .:|  ||.|:...:..|| 
Mouse    87 VITCEYLDEAYPEK-KLFPDDPYKKA--RQKMTLES----------FSKVPPLIASFVRSKRKED 138

  Fly   131 ---RYDAVIEIYDFVETFLTGH-DFIAGDQLTIADFSLITSITALAVFVVIDTVKYANIT-AWIK 190
               ..:|:...:..:|..:..: .|:.||..::.|:                      :| .|.:
Mouse   139 SPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDY----------------------LTWPWFQ 181

  Fly   191 RIEELPYYE 199
            |:|.|...|
Mouse   182 RLEALELKE 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 49/199 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/117 (19%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 24/71 (34%)
GstA 26..224 CDD:223698 51/204 (25%)