DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Gstt1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:234 Identity:68/234 - (29%)
Similarity:96/234 - (41%) Gaps:41/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDS 68
            |.||....|.|.||..:......||::...:.....|.||..|.|.||...||.:.|.|..:.:|
Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67

  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLR---------GITKPLFATGQ 124
            .||..||..||...|..||:||..||.||:.|.::.     .|||         .:..|:|...|
Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQH-----TGLRRSCLRALWHKVMFPVFLGEQ 127

  Fly   125 TTIPKERYDAVIEIYD-----FVETFLTGHDFIAGDQLTIADFSLITSIT-----ALAVFVVIDT 179
              ||.|...|.:...|     ..:.||...||:.|..:::||...||.:.     ...||     
Mouse   128 --IPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVF----- 185

  Fly   180 VKYANITAWIKRIEELPYYEEACGKG----ARDLVTLLK 214
            ..:..:.||.:|:      |.|.||.    |.:::..:|
Mouse   186 EGHPRLAAWYQRV------EAAVGKDLFREAHEVILKVK 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 62/210 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 35/140 (25%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 67/226 (30%)
GST_N_Theta 3..78 CDD:239348 25/74 (34%)