DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and AIMP3

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_061501516.1 Gene:AIMP3 / 1275730 VectorBaseID:AGAMI1_003941 Length:180 Species:Anopheles gambiae


Alignment Length:85 Identity:18/85 - (21%)
Similarity:40/85 - (47%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSI-TALAVFVVIDTVKYANITAWIKRI 192
            |:::.|. .:.|.:..:|....::..|.|::||..:..:| ..:|....::...:.|::.|...:
Mosquito    88 KDKHTAK-SLLDELNFYLQSRSYLVNDTLSVADVVVFHTIHETMANLQPLEKENFLNVSRWFHHL 151

  Fly   193 EELPYYEEACGKGARDLVTL 212
            ::|.  |...||...:..||
Mosquito   152 QQLG--EVRQGKNLLNFSTL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 16/80 (20%)
AIMP3XP_061501516.1 None

Return to query results.
Submit another query.