DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTO2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:200 Identity:48/200 - (24%)
Similarity:81/200 - (40%) Gaps:29/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPE-FLRKNPQHTVPTLE-DDGHFIWDS 68
            :|.....|.....:|.|.|..|.:|.|.||...|    || :..|:|...:|.|| .....|::|
Human    26 IYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNK----PEWYYTKHPFGHIPVLETSQCQLIYES 86

  Fly    69 HAISAYLVSKY-GQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLF--------ATGQ 124
            .....||...| |:.  |:|.|..:||  .|::..|   :|.. :..:||...        .|..
Human    87 VIACEYLDDAYPGRK--LFPYDPYERA--RQKMLLE---LFCK-VPHLTKECLVALRCGRECTNL 143

  Fly   125 TTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYA-NITAW 188
            ....::.:..:.||.::..|     .|..|..:::.|:.|......|.|:.::|.|.:. .:..|
Human   144 KAALRQEFSNLEEILEYQNT-----TFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLW 203

  Fly   189 IKRIE 193
            |..::
Human   204 ISAMK 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 48/199 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/111 (19%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 21/71 (30%)