DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Clic1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_254279.1 Gene:Clic1 / 114584 MGIID:2148924 Length:241 Species:Mus musculus


Alignment Length:183 Identity:41/183 - (22%)
Similarity:65/183 - (35%) Gaps:52/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSH 69
            :|||||........:..|.|:..|..|.|:..|            ||:.....|:....|     
Mouse    67 LLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAAL------------NPESNTSGLDIFAKF----- 114

  Fly    70 AISAYLVSKYGQSDTLYPKDLLQR-AVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYD 133
              |||:.:.....:....|.||:. .|:|..|               |.||        |:|..:
Mouse   115 --SAYIKNSNPALNDNLEKGLLKALKVLDNYL---------------TSPL--------PEEVDE 154

  Fly   134 AVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANIT 186
            ...|     :..::...|:.|::||:||.:|:..:.    .|.:...||...|
Mouse   155 TSAE-----DEGISQRKFLDGNELTLADCNLLPKLH----IVQVVCKKYRGFT 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 41/183 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/71 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/97 (22%)
Clic1NP_254279.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 7/22 (32%)
O-ClC 6..241 CDD:129941 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.