DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Gstt3

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_598755.1 Gene:Gstt3 / 103140 MGIID:2143526 Length:241 Species:Mus musculus


Alignment Length:205 Identity:56/205 - (27%)
Similarity:88/205 - (42%) Gaps:23/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDS 68
            |.||....|.|.||..:.....|||::...|..|..:..:..|.:.||...||.|:|....:.:|
Mouse     3 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDGDFVLAES 67

  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITK----PLFATGQTTIPK 129
            .||..||..||...|..||:||..||.||:.|.::...:.....|.:.:    |:| .||...|:
Mouse    68 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMFPVF-LGQPVPPE 131

  Fly   130 ------ERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSI-----TALAVFVVIDTVKYA 183
                  ...|..:::.:  :.||....|:.|..:::||...||.:     ....:|     ....
Mouse   132 MLASTLAELDGCLQVLE--DKFLRNQAFLTGSHISVADLVAITELMHPVSAGCKIF-----ESRP 189

  Fly   184 NITAWIKRIE 193
            .:.||.:|:|
Mouse   190 KLAAWRQRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 56/205 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/118 (21%)
Gstt3NP_598755.1 GstA 3..217 CDD:223698 56/205 (27%)
GST_N_Theta 3..78 CDD:239348 24/74 (32%)