DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and EEF1E1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens


Alignment Length:155 Identity:35/155 - (22%)
Similarity:58/155 - (37%) Gaps:38/155 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QHTVPTLE-DDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFE----SGVIFANA 111
            :..:|.|: ::|..:.....|.|:||.:..| :.|......::|:|.|.|.:.    .|....|.
Human    27 ERQIPVLQTNNGPSLTGLTTIAAHLVKQANK-EYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKND 90

  Fly   112 LRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVK 176
            :.::.|.                       |..:|....|:.|...|:||   |.....|..|: 
Human    91 IHTLLKD-----------------------LNSYLEDKVYLTGYNFTLAD---ILLYYGLHRFI- 128

  Fly   177 VDTT-----KYPRIAAWFKRLQKLP 196
            ||.|     ||..::.||..:|..|
Human   129 VDLTVQEKEKYLNVSRWFCHIQHYP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 34/153 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 6/25 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/115 (23%)
EEF1E1NP_004271.1 N-terminal 2..56 7/28 (25%)
Linker 57..63 2/6 (33%)
C-terminal 64..152 25/114 (22%)
GST_C_AIMP3 65..165 CDD:198338 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.