DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and sspA

DIOPT Version :10

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:201 Identity:46/201 - (22%)
Similarity:79/201 - (39%) Gaps:33/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYGKT 82
            |::.||...|.:|...|.   |:|..::.:..||..:||||.|....:|:|..|:.||..::...
E. coli    25 VRIVLAEKGVSFEIEHVE---KDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHP 86

  Fly    83 D--SLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKF 145
            .  .:||.     |..:.||:          :..|.|..:....|:|.....:|........|:.
E. coli    87 PLMPVYPV-----ARGESRLY----------MHRIEKDWYTLMNTIINGSASEADAARKQLREEL 136

  Fly   146 LAGNDYVAGNQLTIAD-FSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKLPYYEEANGNGARTF 209
            ||...........::| ||::      :.::.....:.|::...|..    |..:|..|...|.|
E. coli   137 LAIAPVFGQKPYFLSDEFSLV------DCYLAPLLWRLPQLGIEFSG----PGAKELKGYMTRVF 191

  Fly   210 E--SFI 213
            |  ||:
E. coli   192 ERDSFL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/58 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/118 (17%)
sspANP_417696.1 sspA 1..211 CDD:236537 46/201 (23%)

Return to query results.
Submit another query.