DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTO1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:200 Identity:53/200 - (26%)
Similarity:88/200 - (44%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLED-DGHYIWDSH 69
            :|.:...|.....:|.|.|..:.:|.:.:|.:   |..|.|.||||...||.||: .|..|::|.
Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININLK---NKPEWFFKKNPFGLVPVLENSQGQLIYESA 87

  Fly    70 AIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFESGV--IFANALRSITKPLFAGKQTMIPKER 131
            ....||...| ||  .|.|.|..::|.....|...|.|  :..:.:||..|..:||.:....|| 
Human    88 ITCEYLDEAYPGK--KLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKE- 149

  Fly   132 YDAIIEVYDFLEKFLAG--NDYVAGNQLTIADFSI---ISTVSSLEVFVKVDTTKYPRIAAWFKR 191
                   :..||:.|..  ..:..||.:::.|:.|   ...:.::::...||.|  |::..|...
Human   150 -------FTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHT--PKLKLWMAA 205

  Fly   192 LQKLP 196
            :::.|
Human   206 MKEDP 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 52/198 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/71 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/112 (21%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 22/70 (31%)