DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and URE2

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:55/233 - (23%)
Similarity:99/233 - (42%) Gaps:45/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLED---DGHYIWD 67
            |:...::|....|.:.|:.|...|..:.::....|:.:.||:..||...||.|.|   |...||:
Yeast   116 LFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE 180

  Fly    68 SHAIIAYLVSKYGKTDS---LYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPK 129
            |.||:.:||:||.|...   |:..||..::.::..|.|::........:::....|..::.....
Yeast   181 SGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASAV 245

  Fly   130 ERY-DAIIEVYDFLEKFLAGN-----------------------------DY---VAGNQLTIAD 161
            ||| |.:..||..:|..||..                             ||   :.|::|||||
Yeast   246 ERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIAD 310

  Fly   162 FSII---STVSSLEVFVKVDTTKYPRIAAWFKRLQKLP 196
            .:.:   :.|..:.:.:|::   :|.:..|.|.:.:.|
Yeast   311 LAFVPWNNVVDRIGINIKIE---FPEVYKWTKHMMRRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 54/231 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/142 (18%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 25/77 (32%)
GST_C_Ure2p 208..350 CDD:198326 26/141 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.