DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and TEF4

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:49/228 - (21%)
Similarity:90/228 - (39%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPT-LEDDGHYIWDSH 69
            || :..||...|.:..::..::..:.|::..      |.||....|....|. |...|..:.::.
Yeast     6 LY-INRSPRNYASEALISYFKLDVKIVDLEQ------SSEFASLFPLKQAPAFLGPKGLKLTEAL 63

  Fly    70 AIIAYLVSKYG---KTDSLYPKDLLQRAVVDQRLHFESGVIFANA--LRSITKPLFAGKQTMIP- 128
            ||..||.::..   :...|...|:::::   |.|.:.|   .||:  :.:|.:| |...:.:|| 
Yeast    64 AIQFYLANQVADEKERARLLGSDVIEKS---QILRWAS---LANSDVMSNIARP-FLSFKGLIPY 121

  Fly   129 -KERYDAIIEVYDFL----EKFLAGNDYVAGNQLTIADFSI-------ISTVSSLEVFVKVDTTK 181
             |:..||.....|.|    :..|....:||...:::.|...       ::|:...|.     ..|
Yeast   122 NKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEW-----RAK 181

  Fly   182 YPRIAAWFKR-----LQKLPYYEEANGNGARTF 209
            :|.:..||..     :.|.|:.|......|.|:
Yeast   182 HPHLMRWFNTVAASPIVKTPFAEVKLAEKALTY 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 45/213 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/71 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/137 (21%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 17/72 (24%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 28/133 (21%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.