DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and YGR201C

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:59/219 - (26%)
Similarity:92/219 - (42%) Gaps:50/219 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VRAVKLTLAALEVPYEFVEVNTRAKENFSEEF-LKKNPQHTVPTLEDDGHYIW---DSHAIIAYL 75
            ||::||.: .|..|.:       |::.:..|| |:|.|....|      |..|   ::.||..||
Yeast    25 VRSLKLDV-KLADPSD-------AQQLYEREFPLRKYPTFVGP------HDEWTLTEAMAIDYYL 75

  Fly    76 V----SKYGKTDSLYPK-DLLQRAVVDQRLHFE--SGVIFANALRSITKPLFAGK-----QTMIP 128
            :    .|......|.|: |...||.:   |.:|  |...|.|.:..:..||...|     :....
Yeast    76 IHLSSDKEAVRQLLGPEGDFKTRADI---LRWESLSNSDFLNEVCEVFFPLIGVKPYNATEFKAA 137

  Fly   129 KERYDAIIEVYDFLEKFLAGNDY-VAGNQLTIADFSIIS----TVSSLEVFVKVDTTKYPRIAAW 188
            :|..|.|:.:|   ||.|....| |..:..|:||  :||    ::..:..|.:...:|:|.:..|
Yeast   138 RENVDTIVSLY---EKRLKKQQYLVCDDHETLAD--LISAAAFSLGFISFFDETWRSKHPEVTRW 197

  Fly   189 FKRLQKLPYYEEANGNGARTFESF 212
            |.|:.|..::|       ..||||
Yeast   198 FNRVIKSRFFE-------GEFESF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 54/201 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/69 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/129 (25%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 19/66 (29%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.