DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and AT1G66235

DIOPT Version :10

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_683473.2 Gene:AT1G66235 / 842939 AraportID:AT1G66235 Length:284 Species:Arabidopsis thaliana


Alignment Length:96 Identity:23/96 - (23%)
Similarity:39/96 - (40%) Gaps:23/96 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RAKENFSEEFLKKNP----------QHTVPTLEDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLL 91
            |..|:|..   :|||          |..:.|:|.....:   ||.|....::  ::......|:.
plant    40 RVAESFEN---RKNPTWSKRSKKSLQCRLQTIEKASKKL---HACIKLCENR--RSSGASSDDIF 96

  Fly    92 QRA--VVDQRLHFESGVIFA---NALRSITK 117
            .:|  ::.|..||:||..|.   |.:|:..|
plant    97 NQAKEMLMQDKHFKSGWKFDHVWNIIRNFEK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/49 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 10/32 (31%)
AT1G66235NP_683473.2 NAM-associated 114..266 CDD:464129 4/14 (29%)

Return to query results.
Submit another query.