DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and clic3

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:216 Identity:49/216 - (22%)
Similarity:73/216 - (33%) Gaps:69/216 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VRAVKLTLAALEV----------------PYEFVEVNTRAKENFSEEFLKKN---PQHTVPTL-- 58
            ::.|..||..:::                |:.......|...|..||||:..   ||:  |.|  
Zfish    35 LKGVNFTLTTVDMKRAPEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFLEDTLAPPQY--PKLCC 97

  Fly    59 -----EDDGHYIWDSHAIIAYLVS-KYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITK 117
                 ...|..|:  |...||:.: ..|..|.|..|.|.....:||.|                 
Zfish    98 RYKESNTAGDDIF--HKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQYL----------------- 143

  Fly   118 PLFAGKQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
                  .|.:|.       |:....|...:...|:.||.|::||.:::..:.    .|||...||
Zfish   144 ------LTPLPH-------ELDQNPELSTSTRHYLDGNALSLADCNLLPKLH----IVKVVCKKY 191

  Fly   183 P--RIAAWFKRLQKLPYYEEA 201
            .  .|.|..|.|.|  |.::|
Zfish   192 RGFEIPAELKGLSK--YLDKA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 47/209 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/87 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/113 (22%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 11/56 (20%)
O-ClC 6..237 CDD:129941 49/216 (23%)
GST_C_CLIC3 99..231 CDD:198332 35/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.