DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTF7

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:217 Identity:53/217 - (24%)
Similarity:92/217 - (42%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65
            |..:.::|..||...|.|.:.|....:.:|||.:..:..|:..|.|:.:||...||..||....:
plant     1 MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKL 65

  Fly    66 WDSHAIIAYLVSKY----GKTDSLYPKDLLQRAV-----------VDQRLHFESGVIFANALRSI 115
            ::|.||..|:...|    .:..||..||:...|:           |..:|.:|          .:
plant    66 FESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWE----------QV 120

  Fly   116 TKPLFAGKQT--MIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVD 178
            .|||: |..|  .:.:|....:.:|.|..|..|..:.|:|.::.|:.|   :.|:..::..:...
plant   121 LKPLY-GMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVD---LHTIPVIQYLLGTP 181

  Fly   179 TTKY----PRIAAWFKRLQKLP 196
            |.|.    |.::||...:...|
plant   182 TKKLFDERPHVSAWVADITSRP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 51/212 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/123 (20%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 22/72 (31%)
GST_C_Phi 95..209 CDD:198296 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.