DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTF4

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:176 Identity:50/176 - (28%)
Similarity:79/176 - (44%) Gaps:13/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHA 70
            ::|...|...|.|...|....:.||.:.|..:..|:.:|.||..||...||..||....:::|.|
plant    39 VHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRA 103

  Fly    71 I---IAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALR----SITKPLFAGKQT--M 126
            |   |||:.|..| |..|..:.....|.:...:..|:......|.:    .:.||:: |.:|  .
plant   104 ITQYIAYVHSSRG-TQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIY-GLETDQT 166

  Fly   127 IPKERYDAIIE-VYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSL 171
            |.||. :||:| |.:..||.|..:.::|.|..|:.|...:..:..|
plant   167 IVKEN-EAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 50/176 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/88 (25%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 21/69 (30%)
GST_C_Phi 126..243 CDD:198296 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.