DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTT3

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:221 Identity:59/221 - (26%)
Similarity:96/221 - (43%) Gaps:27/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
            ||.:|....|.|.|||.:.....|:.::.:.:....::..|.||...||...||.:.|....:.:
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSE 66

  Fly    68 SHAIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFESGVIFANA----LRSITKPLFAGKQTMI 127
            ||||:.||.|.| ...|..||.||.:||.:...|.:....:...|    |.|:..|...  ..:.
plant    67 SHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALG--LPLN 129

  Fly   128 PKERYDAIIEVYDFLEK--------FLAGND--YVAGNQLTIADFSIISTVSSLEVFVKVDTTK- 181
            ||    |..|....|.|        :|.||.  .:..||.:|||.|::..::.|:|....|..: 
plant   130 PK----AAAEAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRL 190

  Fly   182 ---YPRIAAWFKRLQK--LPYYEEAN 202
               :..:..|.:..:|  :|:::|.:
plant   191 LSPHKNVEQWIENTRKATMPHFDEVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 56/212 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/132 (22%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 56/205 (27%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)
GST_C_Theta 92..221 CDD:198292 29/131 (22%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.