DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTT1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:219 Identity:60/219 - (27%)
Similarity:102/219 - (46%) Gaps:19/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65
            |.||.:|....|.|.|||.:......:.::.|.::...::..|.||...||...||.:.|....:
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 WDSHAIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFESGVIFANA----LRSITKPLFAGKQT 125
            ::||||:.||.|.: ...|..||.||.:||.:...|.:....:...|    |.|:..|...  ..
plant    66 FESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALG--LP 128

  Fly   126 MIPKERYDA---IIEVYDFLEKF-LAGN-DYVAG-NQLTIADFSIISTVSSLEVFVKVDTTK--- 181
            :.||...:|   :.:....||.| |.|| .::.| ||.:|||.|::..:..|:|....|..:   
plant   129 LNPKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLS 193

  Fly   182 -YPRIAAWFKRLQK--LPYYEEAN 202
             :.::..|.:..:|  :|:::|.:
plant   194 THKKVEQWIENTKKATMPHFDETH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 56/208 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/128 (23%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 23/74 (31%)
GST_C_Theta 93..223 CDD:198292 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.