DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTF12

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:215 Identity:51/215 - (23%)
Similarity:97/215 - (45%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYG-LEASPPVRAVKLTLAALE--VPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
            ||| :.|:.|.|.:   |..||  :.:|.:.::....|....|.|.:.|...||.:||....:::
plant     5 LYGQVTAACPQRVL---LCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFE 66

  Fly    68 SHAIIAYLVSKYG-KTDSLYPKDLLQRAVVDQRLHFESGVIFANALRS------ITKPLFAGKQT 125
            |.||..|..:|:. :..:|..|.|..||:|||....|:  .:.|.|..      |.||....|..
plant    67 SRAIARYYATKFADQGTNLLGKSLEHRAIVDQWADVET--YYFNVLAQPLVINLIIKPRLGEKCD 129

  Fly   126 MI----PKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFS------IISTVSSLEVFVKVDTT 180
            ::    .|.:...::::|:   ..|:.|.::||.:.|:||.:      .:.:::.:...||...:
plant   130 VVLVEDLKVKLGVVLDIYN---NRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMVKARGS 191

  Fly   181 KYPRIAAWFKRLQKLPYYEE 200
                ...|::.:...|.:::
plant   192 ----FNRWWEEISDRPSWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 50/209 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/126 (20%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 51/215 (24%)
GST_N_Phi 2..77 CDD:239351 22/74 (30%)
GST_C_Phi 91..209 CDD:198296 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.