DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:204 Identity:59/204 - (28%)
Similarity:88/204 - (43%) Gaps:14/204 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHA 70
            |||.|.|..|..|.|.|......:|.|.||..|..:....||..||...||.|:||...:::|.|
plant     5 LYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRA 69

  Fly    71 IIAYLVSKYGK--TDSLYPKDLLQRAVV----DQRLHFESGVIFANALRSITKPLFA-GKQTMIP 128
            |.||:..|:..  ||....:|..:.|:|    :...|..:..|.|...:.|..||.. .....|.
plant    70 ITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIVVPLQGESPNAAIV 134

  Fly   129 KERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVD----TTKYPRIAAWF 189
            :|..:.:.::.|..|:.|....|:||:..|:||   :..|.....|:|..    ....|.:.||:
plant   135 EENLENLGKILDVYEERLGKTKYLAGDTYTLAD---LHHVPYTYYFMKTIHAGLINDRPNVKAWW 196

  Fly   190 KRLQKLPYY 198
            :.|...|.:
plant   197 EDLCSRPAF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 58/200 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/70 (40%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/117 (23%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 59/204 (29%)
GST_N_Phi 2..77 CDD:239351 28/71 (39%)
GST_C_Phi 92..208 CDD:198296 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.