DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTF11

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:212 Identity:60/212 - (28%)
Similarity:100/212 - (47%) Gaps:26/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYG-LEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSH 69
            :|| ::|:.|.| |.|.....::.:|.:.|:....|....:.|.:.|...||.:||....:::|.
plant     5 VYGQIKAANPQR-VLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESR 68

  Fly    70 AIIAYLVSKYGK--TDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLF---AGKQTMIP- 128
            ||..|..:||..  || |..|.|..||:|||.:..|:...:|.||..:...:|   :||...:. 
plant    69 AIARYYATKYADQGTD-LLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVAL 132

  Fly   129 ----KERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFS------IISTVSSLEVFVKVDTTKYP 183
                |.::|.:::||   |..||.|.|:.|::.|:||.|      .|...:||...|    |...
plant   133 VEELKVKFDKVLDVY---ENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLV----TSRE 190

  Fly   184 RIAAWFKRLQKLPYYEE 200
            .:..|:..:...|.:::
plant   191 NLNRWWNEISARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 59/206 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/124 (27%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 60/212 (28%)
GST_N_Phi 2..77 CDD:239351 20/72 (28%)
GST_C_Phi 91..209 CDD:198296 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.