DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GSTF9

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:233 Identity:54/233 - (23%)
Similarity:103/233 - (44%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDS 68
            |.:||...:.|.||: :||....|.:|.:.|:....|:....:|...|..|||.:.|..:.|::|
plant     3 LKVYGPHFASPKRAL-VTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFES 66

  Fly    69 HAIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFES------------GVIFANALRSITKPLF 120
            .|::.|:..|| .:...|..|.:..|..|:|.|..|:            .::||:.:.      |
plant    67 RAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMG------F 125

  Fly   121 AGKQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSL-----EVFVKVDTT 180
            ...:.:| ||..:.:..|.|..|..|:.:.|:||:.:::||.:.:.....|     :.::..|. 
plant   126 PSDEKLI-KESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKDR- 188

  Fly   181 KYPRIAAWFKRLQKLPYYEEANGNGARTFESFIREYNF 218
              ..::||:..:...|.::|.           :.:|:|
plant   189 --KHVSAWWDDISSRPAWKET-----------VAKYSF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 50/209 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/134 (19%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 54/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.