DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:290 Identity:54/290 - (18%)
Similarity:99/290 - (34%) Gaps:109/290 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDS 68
            |:||....|...:.|:|.:|...:..|..:|:....|:....|::.|....||.:....:.|.|.
Human    47 LVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDY 111

  Fly    69 HAIIAYLVSKY-----GKTDSLYP-----------------------------KDLLQRAVVDQR 99
            ..||.|:...:     |:..|.:|                             ::||....:|..
Human   112 DQIIDYVERTFTGGGRGRCPSGFPAQPLAVPTEHVVALMPEVGSLQHARVLQYRELLDALPMDAY 176

  Fly   100 LHFESGVI----------------------FANALRSITK-----------PLFAGKQTMIPKER 131
            .|   |.|                      .|||...:.|           |..:.::.::.|  
Human   177 TH---GCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAK-- 236

  Fly   132 YDAIIEVYD--FLEKFLA------------------GND------YVAGNQLTIADFSIISTVSS 170
               |:|..|  :|:|.|.                  .|:      ::.|...|:||..:.:|:..
Human   237 ---ILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHR 298

  Fly   171 LEVFVKVDTTKY------PRIAAWFKRLQK 194
            |: |:.: :.||      |.:.::|:|:|:
Human   299 LK-FLGL-SKKYWEDGSRPNLQSFFERVQR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 54/290 (19%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/169 (18%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 54/290 (19%)
GST_N_GDAP1 47..119 CDD:239350 19/71 (27%)
GST_C_GDAP1L1 220..330 CDD:198335 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.