Sequence 1: | NP_611329.1 | Gene: | GstE7 / 37112 | FlyBaseID: | FBgn0063493 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243666.1 | Gene: | GDAP1L1 / 78997 | HGNCID: | 4213 | Length: | 386 | Species: | Homo sapiens |
Alignment Length: | 290 | Identity: | 54/290 - (18%) |
---|---|---|---|
Similarity: | 99/290 - (34%) | Gaps: | 109/290 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDS 68
Fly 69 HAIIAYLVSKY-----GKTDSLYP-----------------------------KDLLQRAVVDQR 99
Fly 100 LHFESGVI----------------------FANALRSITK-----------PLFAGKQTMIPKER 131
Fly 132 YDAIIEVYD--FLEKFLA------------------GND------YVAGNQLTIADFSIISTVSS 170
Fly 171 LEVFVKVDTTKY------PRIAAWFKRLQK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE7 | NP_611329.1 | GstA | 4..196 | CDD:223698 | 54/290 (19%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 19/72 (26%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 31/169 (18%) | ||
GDAP1L1 | NP_001243666.1 | GstA | 47..333 | CDD:223698 | 54/290 (19%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | 19/71 (27%) | ||
GST_C_GDAP1L1 | 220..330 | CDD:198335 | 22/114 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154532 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |