DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001072239.1 Gene:gdap1l1 / 779687 XenbaseID:XB-GENE-950543 Length:364 Species:Xenopus tropicalis


Alignment Length:278 Identity:59/278 - (21%)
Similarity:107/278 - (38%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PK----LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDG 62
            ||    |:||....|...:.::|.:|....|.:..:|:....|:....|::.|....||.:....
 Frog    39 PKSKDTLVLYHWTQSFSSQKIRLVIAEKGFPCDERDVSLPLTEHKEPWFMRLNLGEEVPVVIHGD 103

  Fly    63 HYIWDSHAIIAYLVSKY---------GKTDSLYPKDLLQ-RAVVDQR----------LHFE---S 104
            :.|.|.:.||.|:.:.:         .:|::::...:|| |.::|:.          ||.|   .
 Frog   104 NIISDYNQIIDYIENNFVGELIPKLIPETETIFHSRVLQYREILDKLPMDAYTHGCILHPELTTD 168

  Fly   105 GVI-----------FANALRSITKPLFAGKQTMIP-----KERYDAIIE---------------- 137
            .:|           .|||...:||......|.|.|     |:....|:|                
 Frog   169 SMIPKYATAEIRRHLANASTELTKLDHEEPQLMEPYLSKQKKLMAKILEHDNVNYLTKILIQLSM 233

  Fly   138 VYDFLEKFLAGND----------YVAGNQLTIADFSIISTVSSLEVFVKVDTTKY------PRIA 186
            |.|.:|..|....          ::.|:..|:||..:.:|:..|: |:.: :.||      |.:.
 Frog   234 VLDQIEAELEKRKLEYEGQKCELWLCGHIFTLADVLLGATLHRLK-FLGL-SKKYWEDGSRPNLQ 296

  Fly   187 AWFKRLQKLPYYEEANGN 204
            .:|.|:||...:.:..|:
 Frog   297 LFFDRIQKRYAFRKVLGD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 56/262 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/176 (22%)
gdap1l1NP_001072239.1 Thioredoxin_like 45..117 CDD:381987 18/71 (25%)
GST_C_family 198..308 CDD:383119 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.