DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Gstt4

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:229 Identity:58/229 - (25%)
Similarity:104/229 - (45%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLE-----ASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
            |||     .|.|.|||.:......:|::|..|:.....:.|:|:::.||...:|:|:|....:.:
Mouse     2 GLELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDGKFILSE 66

  Fly    68 SHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALR----SITKPLFAGKQTMIP 128
            |.||:.||..||......||.||..||.||:.:.::...|.....:    .:..|:..|::  :|
Mouse    67 SVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEE--VP 129

  Fly   129 KERYDAIIE-----VYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLE-------VFVKVDTTK 181
            .||.:..::     :..|.||||....::.|:.:::||  :::.|..::       |||.     
Mouse   130 TERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLAD--LVALVEMMQPMGSNHNVFVS----- 187

  Fly   182 YPRIAAW----------------FKRLQKLPYYE 199
             .::|.|                .:||.|||.::
Mouse   188 -SKLAEWRMRVELAIGSGLFWEAHERLVKLPNWD 220

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 56/224 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/141 (21%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 46/170 (27%)
GST_N_Theta 3..78 CDD:239348 22/74 (30%)