DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Clic3

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:201 Identity:44/201 - (21%)
Similarity:78/201 - (38%) Gaps:51/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVS 77
            |..:.:.:.|....||:....|:||...:..::|.   |...:|.|..||....|:..|..:|..
Mouse    55 PSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEE 116

  Fly    78 KYGKTD--SLYPK---------DLLQR--AVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPK 129
            ..|..|  ||.|:         |:..:  |.:...:..:...::...||::|             
Mouse   117 TLGPPDFPSLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDNALYQQLLRALT------------- 168

  Fly   130 ERYDAIIEVYDFLEKFLAGND--------YVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIA 186
             |.|:.:...  |:..||...        ::.|:|.|:||.|::   ..|.:   |||     :.
Mouse   169 -RLDSYLRAP--LDHELAQEPHLRESHRRFLDGDQFTLADCSLL---PKLHI---VDT-----VC 219

  Fly   187 AWFKRL 192
            |.|::|
Mouse   220 AHFRQL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 44/201 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/63 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/112 (20%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 44/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.