Sequence 1: | NP_611329.1 | Gene: | GstE7 / 37112 | FlyBaseID: | FBgn0063493 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030107910.1 | Gene: | Clic3 / 69454 | MGIID: | 1916704 | Length: | 268 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 44/201 - (21%) |
---|---|---|---|
Similarity: | 78/201 - (38%) | Gaps: | 51/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 PPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVS 77
Fly 78 KYGKTD--SLYPK---------DLLQR--AVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPK 129
Fly 130 ERYDAIIEVYDFLEKFLAGND--------YVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIA 186
Fly 187 AWFKRL 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE7 | NP_611329.1 | GstA | 4..196 | CDD:223698 | 44/201 (22%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 16/63 (25%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 22/112 (20%) | ||
Clic3 | XP_030107910.1 | O-ClC | 43..261 | CDD:129941 | 44/201 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844732 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |