DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Gsto2

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:204 Identity:40/204 - (19%)
Similarity:83/204 - (40%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDG-HYIWDSH 69
            :|.:...|.....:|.|.|..:.:|.:.:|.::|.::   :..|:|...:|.||:.. ..:::|.
Mouse    26 IYSMRFCPYSHRARLVLKAKGIRHEVININLKSKPDW---YYTKHPFGQIPVLENSQCQLVYESV 87

  Fly    70 AIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFE----------SGVIFANALRSITKPLFAGK 123
            ....||...| |:  .|:|.|..:||  .|::..|          ..:|.....|..|....|.:
Mouse    88 IACEYLDDVYPGR--KLFPYDPYERA--RQKMLLELFCKVPPLSKECLIALRCGRDCTDLKVALR 148

  Fly   124 QTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY-PRIAA 187
            |.:...|      |:.::     ....:..|:.:::.|:.:......|:|:...|...: |.:..
Mouse   149 QELCNME------EILEY-----QNTTFFGGDCISMIDYLVWPWFERLDVYGLADCVNHTPMLRL 202

  Fly   188 WFKRLQKLP 196
            |...:::.|
Mouse   203 WIASMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 39/202 (19%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/71 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/117 (16%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 15/70 (21%)