DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and Gstz1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:205 Identity:65/205 - (31%)
Similarity:102/205 - (49%) Gaps:17/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVN--TRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65
            |.:||....|.....|::.||...:.||.|.:|  ....:.|||||...||...||.|:.||..|
  Rat     5 KPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITI 69

  Fly    66 WDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFE---SGVIFANALRSITKPLFAGKQTMI 127
            ..|.||:.|| .:......|.|:|..:||:|  |:..:   ||:   ..|::::.....|::..:
  Rat    70 GQSLAILEYL-EETRPIPRLLPQDPQKRAIV--RMISDLIASGI---QPLQNLSVLKQVGQENQM 128

  Fly   128 PKERYDAIIEVYDFLEKFL---AGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWF 189
            |..: .||...::.|||.|   ||. |..|:::::||..:...|::.|.| |||.:.||.|:...
  Rat   129 PWAQ-KAITSGFNALEKILQSTAGK-YCVGDEVSMADVCLAPQVANAERF-KVDLSPYPTISHIN 190

  Fly   190 KRLQKLPYYE 199
            |.|..|..::
  Rat   191 KALLALEAFQ 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 63/199 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/74 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/115 (29%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 28/74 (38%)
maiA 7..211 CDD:273527 64/203 (32%)
Glutathione binding. /evidence=ECO:0000250 14..19 1/4 (25%)