Sequence 1: | NP_611329.1 | Gene: | GstE7 / 37112 | FlyBaseID: | FBgn0063493 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038525.1 | Gene: | gstr / 564619 | ZFINID: | ZDB-GENE-090507-1 | Length: | 226 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 50/221 - (22%) |
---|---|---|---|
Similarity: | 94/221 - (42%) | Gaps: | 53/221 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LILYGLEASPPVRAVKLTLAALEVP-YEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
Fly 68 SHAIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLF--AGKQTMIP- 128
Fly 129 -----------KERYDAIIEVYD-FLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTK 181
Fly 182 YPRIAAWFKRLQ--------KLPYYE 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE7 | NP_611329.1 | GstA | 4..196 | CDD:223698 | 47/216 (22%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 19/73 (26%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 28/132 (21%) | ||
gstr | NP_001038525.1 | GstA | 5..207 | CDD:223698 | 50/221 (23%) |
GST_N_family | 5..78 | CDD:238319 | 18/72 (25%) | ||
GST_C_family | 99..199 | CDD:198286 | 27/127 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589756 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100130 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.750 |