DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gdap1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:283 Identity:55/283 - (19%)
Similarity:96/283 - (33%) Gaps:92/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
            |||||....|...:.|:|.:|...:..|..:|:....|:....|::.||...||.|..|.|.|.|
Zfish    39 KLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICD 103

  Fly    68 SHAIIAYLVSKY--GKTDSLYP-------------KDLLQRAVVDQRLHFESGVIF--------- 108
            ...|:.||...:  .:|..|.|             ::||....:|...|   |.|.         
Zfish   104 PTQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTH---GCILHPEITVDSH 165

  Fly   109 ----------------ANALRSIT------KPLFAGKQTMIPKERYD-----AIIEVYDFLEKFL 146
                            .:.|:.:.      |..:..||..:..:.:|     .:.::.|.||..|
Zfish   166 IPAYATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVL 230

  Fly   147 ------------------AGNDYVAGNQLTIADFSIISTVSSLEVF------------VKVDTTK 181
                              :...::.|:..:|||.|:..|:..|:..            |.::|  
Zfish   231 DQVETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTLHRLKFLGLSRRYWGNGMRVNLET-- 293

  Fly   182 YPRIAAWFKRLQKLPYYEEANGN 204
                  :::|:...|.:....|:
Zfish   294 ------YYERVLDRPTFRRVLGH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 52/272 (19%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/180 (14%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 53/277 (19%)
GST_N_GDAP1 40..112 CDD:239350 23/71 (32%)
GST_C_family 193..304 CDD:295467 19/118 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589743
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.