Sequence 1: | NP_611329.1 | Gene: | GstE7 / 37112 | FlyBaseID: | FBgn0063493 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061845.2 | Gene: | GDAP1 / 54332 | HGNCID: | 15968 | Length: | 358 | Species: | Homo sapiens |
Alignment Length: | 271 | Identity: | 55/271 - (20%) |
---|---|---|---|
Similarity: | 95/271 - (35%) | Gaps: | 69/271 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67
Fly 68 SHAIIAYLVSKY----------GKTDSLYPKDLLQRAVVDQR----------LHFE---SGVIFA 109
Fly 110 NALRSITKPL--------------------FAGKQTMIPKERYD-----AIIEVYDFLEKFL--- 146
Fly 147 --------------AGNDYVAGNQLTIADFSIISTVSSLEV--FVKVD--TTKYPRIAAWFKRLQ 193
Fly 194 KLPYYEEANGN 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE7 | NP_611329.1 | GstA | 4..196 | CDD:223698 | 53/260 (20%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 21/72 (29%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 30/173 (17%) | ||
GDAP1 | NP_061845.2 | GST_N_GDAP1 | 26..98 | CDD:239350 | 20/71 (28%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 20/109 (18%) | ||
Required for mitochondrial localization | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154573 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |