DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:209 Identity:59/209 - (28%)
Similarity:106/209 - (50%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGLEASPPVRAVKLTLAALEVPYEFVEVN-TRAKENFSEEFLKKNPQHTVPTLEDDGHYIW 66
            :|.||....|.|.|:|.:...|..:|:.:.::. .:|.|:.::||.|.:..|.||.|:|....:.
 Frog     5 ELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTMA 69

  Fly    67 DSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFE--------SGVIFANALRSITKPLFAGK 123
            :|.|::.||..||...:..||.||.:||.||:.|.::        |.|.:...:    .|...||
 Frog    70 ESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCV----SPTILGK 130

  Fly   124 QTMIPKERYDAIIEVY-----DFLEKFLAGNDYVAGNQLTIADFSIISTV-----SSLEVFVKVD 178
            :  :|.|:.:|::..:     :|.||||....::||:::::||...|..:     |.:.||    
 Frog   131 E--VPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVF---- 189

  Fly   179 TTKYPRIAAWFKRL 192
             .:.|::.:|.:||
 Frog   190 -EERPKLGSWKQRL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 59/208 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/120 (25%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 23/75 (31%)
GST_C_Theta 95..221 CDD:198292 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.