DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and clic5a

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:165 Identity:39/165 - (23%)
Similarity:66/165 - (40%) Gaps:43/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PYEFVEVN--TRAKENFSEEFLK------KNPQHTVPTLEDD--GHYIWDSHAIIAYLVSKYGKT 82
            |..|:..|  .|...|..||||:      |.|:......|.:  |:.|:...:  ||:.:...:.
Zfish    67 PPPFLTFNGEVRTDVNKIEEFLEEMLAPPKYPKLAAKNKESNTAGNDIFAKFS--AYIKNTKPEA 129

  Fly    83 DSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKFLA 147
            ::...|.||:                      :.|.|.:...:.:|.|     |:.....|:..:
Zfish   130 NASLEKGLLK----------------------VLKKLDSFLNSPLPDE-----IDAESTGEEKSS 167

  Fly   148 GNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
            ...|:.||:||:||.:::   ..|.| |||.:.||
Zfish   168 NRKYLDGNELTLADCNLL---PKLHV-VKVVSKKY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 39/165 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/58 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/92 (23%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 9/29 (31%)
O-ClC 10..244 CDD:129941 39/165 (24%)
GST_C_CLIC5 104..244 CDD:198330 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.