DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstD5

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:193 Identity:84/193 - (43%)
Similarity:119/193 - (61%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYG 80
            |.|.:...||.|......:||..|:....||:|.|||||:|||.|:|..||:|.||..|||.|||
  Fly    13 RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77

  Fly    81 KTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLF-AGKQTMIPKERYDAIIEVYDFLEK 144
            |.|:|:|||..::|:|:|||:|:.|.:: ::......||| .||..  ..|.:..|...:::|..
  Fly    78 KDDTLFPKDPKKQALVNQRLYFDMGTLY-DSFAKYYYPLFHTGKPG--SDEDFKKIESSFEYLNI 139

  Fly   145 FLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL-PYYEEANGNGA 206
            ||.|.:||||:.||:||.:|:||||:.|:| ..|..|||.:|.|:...:|: |.:|| |..||
  Fly   140 FLEGQNYVAGDHLTVADIAILSTVSTFEIF-DFDLNKYPNVARWYANAKKVTPGWEE-NWKGA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 78/181 (43%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/60 (47%)
GST_C_Delta_Epsilon 91..209 CDD:198287 46/118 (39%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 77/174 (44%)
GST_N_Delta_Epsilon 1..74 CDD:239343 28/60 (47%)
GST_C_Delta_Epsilon 88..204 CDD:198287 46/118 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460230
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.