DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstD4

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:186 Identity:76/186 - (40%)
Similarity:117/186 - (62%) Gaps:4/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYG 80
            |.:.:...||.:.....::.....|:...||||.|||||:|||.|:|..||:|.||..|||.|||
  Fly    13 RTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYG 77

  Fly    81 KTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKF 145
            |.|||:|.|..:||:::|||:|:.|.:..:.::.....:..|:  :...|.|..:...::||:.|
  Fly    78 KDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQ--LGNAENYKKVEAAFEFLDIF 140

  Fly   146 LAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL-PYYEE 200
            |.|.|||||:|||:||.:|:|:||:.|| |:.|.:|||.:|.|:...:|: |.::|
  Fly   141 LEGQDYVAGSQLTVADIAILSSVSTFEV-VEFDISKYPNVARWYANAKKITPGWDE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 74/180 (41%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/60 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 41/111 (37%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 73/173 (42%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/60 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 41/111 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460308
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.