DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstD3

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:193 Identity:80/193 - (41%)
Similarity:121/193 - (62%) Gaps:5/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYGKTDSLYPK 88
            ||.:.:....:||...|..:.:|:|.||||::|||.|:|..||:|.||:.|||.||||.|:||||
  Fly     5 ALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPK 69

  Fly    89 DLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKFLAGNDYVA 153
            |:.::||::|||:|:..:::........|....|:  ...:|.|..:.|.:|||..||.|.||||
  Fly    70 DIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQ--FGSEEDYKKVQETFDFLNTFLEGQDYVA 132

  Fly   154 GNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL-PYYEEANGNGARTFESFIRE 215
            |:|.|:||.:|::.||:.:| |..|.:|||.:|.|:..::|: |.:|| |..||...:..|.|
  Fly   133 GDQYTVADIAILANVSNFDV-VGFDISKYPNVARWYDHVKKITPGWEE-NWAGALDVKKRIEE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 72/172 (42%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/52 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 44/118 (37%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 23/52 (44%)
GstA 6..173 CDD:223698 70/169 (41%)
GST_C_Delta_Epsilon 72..188 CDD:198287 44/119 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460347
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.