DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:191 Identity:48/191 - (25%)
Similarity:86/191 - (45%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALEVPYEFVEVNTRAKENF-------SEEFLKKNPQHTVPTLED-DGHYIWDSHAII 72
            ||.|..:||     ::.....:..:||       |.|||||.|...||..|. :|.|:.:|:| |
  Fly    14 RAYKALIAA-----QYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNA-I 72

  Fly    73 AYLVS----KYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFA---GKQTMIPKE 130
            |||::    :.||...:       :|.|.|.:.|....|...:...:. ||..   .::....|:
  Fly    73 AYLLANEQLRGGKCPFV-------QAQVQQWISFADNEIVPASCAWVF-PLLGILPQQKNSTAKQ 129

  Fly   131 RYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTK--YPRIAAWF 189
            ..:|:::.   |.:.|....::||.::|:||..:.|::..|..:|...:.:  :..:..||
  Fly   130 EAEAVLQQ---LNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 48/191 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/68 (37%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/104 (20%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 25/70 (36%)
GstA 5..187 CDD:223698 46/189 (24%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 21/102 (21%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.