DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gsto1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:236 Identity:63/236 - (26%)
Similarity:100/236 - (42%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPK--LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE-DDG 62
            :||  :.||.:...|..:..:|.|.|..:.|:.:.:|.:.|.::   ||:|||...||.|| ..|
Zfish    18 VPKDHIRLYSMRFCPFAQRTRLVLNAKGIKYDTININLKNKPDW---FLEKNPLGLVPVLETQSG 79

  Fly    63 HYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMI 127
            ..|::|.....||...|.: ..|.|.|..:||  .||:..|        |.|...|.|    ..|
Zfish    80 QVIYESPITCEYLDEVYPE-KKLLPFDPFERA--QQRMLLE--------LFSKVTPYF----YKI 129

  Fly   128 PKER-----YDAI-IEVYDFLEKFLAGND--------YVAGNQLTIADFSIISTVSSLEVF-VK- 176
            |..|     ..|: .|:.|.|.:|   |:        :..|:.:|:.|:.:......||.. :| 
Zfish   130 PVNRTKGEDVSALETELKDKLSQF---NEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKH 191

  Fly   177 -VDTTKYPRIAAWFKRLQKLPYYEEANGNGARTFESFIREY 216
             :|.|  |.:..|.:|:.:.|.. :|......|:..|.:.|
Zfish   192 CLDGT--PELKKWTERMMEDPTV-KATMFSTETYMVFYKSY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 56/209 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/134 (23%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 24/77 (31%)
GstA 25..210 CDD:223698 56/207 (27%)
GST_C_Omega 107..229 CDD:198293 33/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.