DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstD11

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:211 Identity:78/211 - (36%)
Similarity:111/211 - (52%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSH 69
            :||.|..|||.|::.|....|::.:|...||....|....:|:..||||.|||:.|:|..:|:|.
  Fly    26 VLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESR 90

  Fly    70 AIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFAN------ALRSITKPLFAGKQTMIP 128
            ||::|||:.|||:|.|||.|:..||:|||||.|:.|.::..      ....|..||..||:.   
  Fly    91 AILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRA--- 152

  Fly   129 KERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQ 193
                 .:.|...:|...|.|..:.|.:..||||.:::.|||.||.| :.:...|..|..|..|.:
  Fly   153 -----KLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAF-EFELRPYKHIRQWLDRCK 211

  Fly   194 --KLPY-YEEANGNGA 206
              ..|: |||.|.|.|
  Fly   212 DHMAPFDYEELNANKA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 71/198 (36%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/71 (41%)
GST_C_Delta_Epsilon 91..209 CDD:198287 40/125 (32%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 29/71 (41%)
GST_C_Delta_Epsilon 112..231 CDD:198287 40/125 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.