DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and clic5b

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:166 Identity:45/166 - (27%)
Similarity:62/166 - (37%) Gaps:49/166 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LKKNPQ--HTV------PTLEDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFE 103
            ||:.|.  |.:      |.|..:|....|.:.|..:|........  ||| |..|       |.|
Zfish   214 LKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEEVLAPPK--YPK-LAAR-------HRE 268

  Fly   104 SGV----IFA--NALRSITKP-----LFAGKQTMIPK----------ERYDAIIEVYDFLEKFLA 147
            |..    |||  :|....|||     |..|....:.|          :..||     |.:|:..|
Zfish   269 SNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALKKLDEYLNSPLPDEVDA-----DSMEEEKA 328

  Fly   148 GN-DYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
            .| .::.||.||:||.:::..:.    .|||...||
Zfish   329 SNRRFLDGNDLTLADCNLLPKLH----IVKVVAKKY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 45/166 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 10/37 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/114 (27%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 10/46 (22%)
O-ClC 172..407 CDD:129941 45/166 (27%)
GST_C_CLIC5 266..406 CDD:198330 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.