DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and clic5b

DIOPT Version :10

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:166 Identity:45/166 - (27%)
Similarity:62/166 - (37%) Gaps:49/166 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LKKNPQ--HTV------PTLEDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFE 103
            ||:.|.  |.:      |.|..:|....|.:.|..:|........  ||| |..|       |.|
Zfish   214 LKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEEVLAPPK--YPK-LAAR-------HRE 268

  Fly   104 SGV----IFA--NALRSITKP-----LFAGKQTMIPK----------ERYDAIIEVYDFLEKFLA 147
            |..    |||  :|....|||     |..|....:.|          :..||     |.:|:..|
Zfish   269 SNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALKKLDEYLNSPLPDEVDA-----DSMEEEKA 328

  Fly   148 GN-DYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY 182
            .| .::.||.||:||.:::..:.    .|||...||
Zfish   329 SNRRFLDGNDLTLADCNLLPKLH----IVKVVAKKY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343 10/37 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/114 (27%)
clic5bNP_998062.1 EFh_CREC <53..150 CDD:330175
EF-hand motif 81..119 CDD:320021
EF-hand motif 126..150 CDD:320021
O-ClC 172..407 CDD:129941 45/166 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.