DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and gstt1b

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:210 Identity:54/210 - (25%)
Similarity:101/210 - (48%) Gaps:28/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76
            |.|.|:|.:......:.:::.:::......:.|||.|.||....||::|....:.:|.||:.||.
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    77 SKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALR----SITKPLFAGKQTMIPKERYDAIIE 137
            .|:...|..:|.||.:||.|::.|.::...|..:..:    .|..|...|.:  :|||:.:...|
Zfish    76 DKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAE--VPKEKMENAEE 138

  Fly   138 VYD-----FLEKFLAGNDYVAGNQLTIADFSIISTV-----SSLEVFVKVDTTKYPRIAAWFKRL 192
            ..:     |.:|||....::.|:|:::||...|..:     :.::||     ...|::.||..|:
Zfish   139 NLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVF-----ENRPKLKAWKDRV 198

  Fly   193 Q-----KLPYYEEAN 202
            :     ||  ::||:
Zfish   199 RVAIGAKL--FDEAH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 51/202 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/64 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/131 (24%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 50/194 (26%)
GST_N_Theta 3..78 CDD:239348 18/66 (27%)
GST_C_Theta 91..217 CDD:198292 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.