DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstO1

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:179 Identity:49/179 - (27%)
Similarity:73/179 - (40%) Gaps:43/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE---DDGH-Y 64
            |.||.:...|....|.|.|.|.::||..:.:|.|.|   .|.|...:....||.||   :.|: .
  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDK---PEWFSLVSSSTKVPALELVKEQGNPV 83

  Fly    65 IWDSHAIIAYLVSKYGKTDSLYPKDLLQRA---VVDQRL-----------------------HFE 103
            :.:|..|..||..||.:. .|||||||::|   ::.:|.                       |:.
  Fly    84 LIESLIICDYLDEKYPEV-PLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYA 147

  Fly   104 SGVIFANALRSITKPLFAGKQ------TMIP-KERYDAIIEVYDFLEKF 145
            ..|::...|:......|.|..      .|.| .||:|::  .|.|.:||
  Fly   148 GLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSL--KYTFEQKF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 49/179 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/76 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 17/88 (19%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 23/75 (31%)
GstA 22..216 CDD:223698 49/179 (27%)
GST_C_Omega 109..234 CDD:198293 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.