DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and GstO2

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:87/203 - (42%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE----DDGHYIWD 67
            :.:...|....|:|.|||..:.:..:.|:...|..:.::|   :|...||.|:    .|...:.:
  Fly    26 FSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDF---SPLGKVPALQLTGVKDQPTLVE 87

  Fly    68 SHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERY 132
            |..|..||..:|.:| .|:|.|.||:|:  .::..|.   ||..:.:|...|     |..|....
  Fly    88 SLIIAEYLDQQYPQT-RLFPTDPLQKAL--DKILIER---FAPVVSAIYPVL-----TCNPNAPK 141

  Fly   133 DAI------IEVYDFLEKFLAGNDYVAGNQLTIADFSI-----------ISTVSSLEVFVKVDTT 180
            |||      ::|:: :|....|..|.||..:.|.|:.|           |:|....|    :||.
  Fly   142 DAIPNFENALDVFE-VELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYE----LDTK 201

  Fly   181 KYPRIAAW 188
            ::.::..|
  Fly   202 RFEKLLKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 51/203 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/73 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/115 (24%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 17/72 (24%)
GstA 25..215 CDD:223698 51/203 (25%)
GST_C_Omega 110..235 CDD:198293 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.