DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE7 and se

DIOPT Version :9

Sequence 1:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:218 Identity:58/218 - (26%)
Similarity:97/218 - (44%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE---DDG-HY 64
            |.||.:...|..:.|.|.|.|.::||..:.:|...|   .|..|:||||..||.||   :.| ..
  Fly    22 LRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDK---PEWLLEKNPQGKVPALEIVREPGPPV 83

  Fly    65 IWDSHAIIAYLVSKYGKTDSLYPKDLLQRA---VVDQRLHFESGVIFANALRSITKPLFAGKQTM 126
            :.:|..|..||..:| ....|||:|.|::.   ::.:|.....|..|..:.....:|.::|    
  Fly    84 LTESLLICEYLDEQY-PLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPFWSG---- 143

  Fly   127 IPKERYDAIIEVYDFLEKFLA--GNDYVAGNQLTIADFSIISTVSSLEVF-------VKVDTTKY 182
                     :::|   |:.||  |.::..|.|..|.|:.|......||:.       ...|.:::
  Fly   144 ---------LDIY---ERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRF 196

  Fly   183 PRIAAWFKRLQKLP----YYEEA 201
            |::..|.:|:::.|    :|.||
  Fly   197 PQLTLWLERMKRDPAVMAFYMEA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 54/207 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/76 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/127 (20%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 26/75 (35%)
GstA 22..215 CDD:223698 55/212 (26%)
GST_C_Omega 109..229 CDD:198293 26/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.